In total 46653
number of Products info
Category:
Choose
VIP
Image
Price
-
- Cotton Rope Dog Leash Handmade Cotton Dog Leash Supplies
- Model Number: SNH-DL-996-#2772 Brand Name: S N HANDICRAFTS Key Specifications/Special Features: Dog leashes in colorful variations and great designsWilling to present your dog with the best dog leash?In case, the answer is yes, we are happy to...
Shenzhen Stansen Industrial Co.,Ltd. [Verified]
-
- Pet garbage bag, made of HDPE
- Model Number: WLGP01-#2361 Key Specifications/Special Features: Material: HDPECustomized sizes and thicknesses are acceptedPacking: inner box or polybagColor: customizedUsed for collecting the pet waste Shipping Information: FOB Port: Qingd...
Qingdao Yurui Package Co. Ltd [Verified]
-
- Memory Foam Pet Bed
- Model Number: WYDB-006 Key Specifications/Special Features: Type: dogsItem: pets bed/pets homeWash style: mechanical washPattern: fiberColor: banana yellow Shipping Information: FOB Port: Ningbo Main Export Markets: AsiaAustra...
Yiwu Senye IMP&EXP Co.,Ltd [Verified]
-
- Water Pump for Pond Swimming Pool DC for Solar or Submersible Pumping System
- Model Number: ZDB35-1 Brand Name: GORDON Key Specifications/Special Features: Pump:>>Pump body: cast iron and supports under special anti-rust treatment>>Impeller: stainless steel impeller, brass impeller, PPO impeller>>Mechani...
Fujian Gordon Pump Industry Co. Ltd [Verified]
-
- Sell like cakes aquarium stone
- Model Number: ZXAS-2-# Key Specifications/Special Features: Aquarium rock ZXAShape: natural shape and colourMaterial: natural stoneSizes: 10-25, 10-30 and 30-50cmPacking: 800kg/big bagPurpose: aquarium, garden Shipping Information: FOB Port...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- Pet Retractable Leash, For Dog
- Model Number: XR-P010-238-4 Brand Name: Xuerui Key Specifications/Special Features: Feature:Item: Pet Retractable Leash, For DogMaterial: ABS, TPR, nylon.Color: red, green, pink, blue or customized.Logo: customized.Withhigh strength nylon leas...
Shanghai Xuerui Imp. & Exp. Co. Ltd(Pet Products Dept) [Verified]
-
- Solar or submersible pumping system automatic home booster pump for cold and hot water
- Model Number: PS-128D Brand Name: GORDON Key Specifications/Special Features: Pump:>>Pump body: cast iron and supports under special anti-rust treatment>>Impeller: stainless steel impeller, brass impeller, PPO impeller>>Mechani...
Fujian Gordon Pump Industry Co. Ltd [Verified]
-
- Pet Retractable Leash, For Dog
- Model Number: XR-P010-240 Brand Name: Xuerui Key Specifications/Special Features: Feature:Item: pet dog retractable leashMaterial: ABS, TPR, nylon.Color: pink, blue or customized.Logo: customized.Withhigh strength nylon leash, super endurance....
Shanghai Xuerui Imp. & Exp. Co. Ltd(Pet Products Dept) [Verified]
-
- Dog Harness, Suitable for Outdoor Activities, Made of Breathable Nylon
- Model Number: SDL-5020 Brand Name: Senful Pet Key Specifications/Special Features: Made of breathable nylonSafest and most comfortable harness allows pet freedom of enjoying his natural habitat and outdoor activitiesHarness features an easy on/o...
Shanghai Senful Pet Products Co. Ltd [Verified]
-
- Munchy Dog Chew Stick for Pet Treat
- Model Number: MP170 Key Specifications/Special Features: 1. SpecificationsAvailable in 2",4"Natural, palatable, healthyHigh in protein and low in fatFavorable MOQ,OEM available2. Ingredient listCattle hide: 54.4%Chicken: 30%Tapioca: 15%Glycery...
JIANGXI HUAHENG PET FOOD., LTD. [Verified]
-
- Pet collars
- Model Number: IDO-C004-#1864 Key Specifications/Special Features: 1. Webbing: polyester/nylon/PP materials available based on minimum order quantity we request2. Plastic/hardware parts: eco-friendly and passed relative tests3. Stitching: broth...
Shaoxing Fuquan Ido Pet Products Factory [Verified]
-
- Pet Foam Beds, Used for Dogs
- Model Number: XR-P005-061 Brand Name: Xuerui Key Specifications/Special Features: Features:Pet Foam Beds, Used for DogsItem: pet bed, dog bed.Material: canvas, short plush, PP cotton, sponge or customized.Pattern: camo, animal or customized.Co...
Shanghai Xuerui Imp. & Exp. Co. Ltd(Pet Products Dept) [Verified]
-
- Retractable Pet Dog Leash Lead, Made of ABS
- Model Number: RT 3032 Key Specifications/Special Features: Description: one-hand-operated braking and retracting system is easy to use Brake button and brake lock are ergonomically conceived Comfortable hand-shaped grip Heavy duty and durable ...
MoGo Pet Co. Limited [Verified]
-
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
-
- Diamond Shape Dog Beds, Striped Printing, Canvas and Oxford
- Model Number: COO-2035-2 Brand Name: COOBY PET Key Specifications/Special Features: Product description:Item name: diamond shape dog beds, striped printing, canvas and OxfordSizes: 60*16cm/70*18cm/80*18cmColors: grey, as your optionsMaterials: c...
WENZHOU COOBY PET SUPPLIES CO., LTD [Verified]
-
- Usable, Good Quality, for Pets, Dog Chew Toys
- Model Number: VB-0039 Brand Name: No brand Key Specifications/Special Features: Product name: usable, good quality, for pets, dog chew toysProduct weight: 80gProduct material: TPRProduct color: any colors for your choice Shipping In...
Ningbo Vision Import&Export Co., Ltd [Verified]
-
- Puppy Kitty Small Pet Cotton Polo Shirt Clothes Costume Apparel
- Model Number: 183079201 Brand Name: OEM Key Specifications/Special Features: Clothe for your pet puppy kittyHave you clothed for your pet dog or cat? He also wants his own clothes like you. This pet polo shirt is good clothes for your pet. Fas...
Shenzhen Joyline E-commerce Co.,Ltd [Verified]
-
- Classic America Flag Needlepoint Dog Collar
- Model Number: ZY-23550A Brand Name: Janyo Key Specifications/Special Features: Material: cowhideItem#: ZY-23550ASize: 2.0*50cmColor: stripe white& redSample lead time: 5-7 daysProduction lead time: 30-45 daysOEM/ODM services are providedProm...
-
- Tank rock decorations
- Model Number: ZXA-37 Brand Name: zongxiao Key Specifications/Special Features: Our company supplies various kinds of stone for aquarium and gardenAquarium rock ZXA-061. Shape: natural shape such as mountain, surface drape2. Material: natural s...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- Professional stainless steel pet nail clipper
- Model Number: QT-PET-21 Brand Name: Q&T Key Specifications/Special Features: Key specifications/special features:1. Professional stainless steel blade,feelcomfortablehandleABS + TPR + stainless steel blade2. Size: 10.4cm, cutting part: 3.4...
Ningbo Q&T Industrial Co. Ltd [Verified]
Top Search This Week
- 2timesShower
New Products
-
Commercial Air Source Heat Pump
price: Negotiable
-
High Temperature Heat Pump
price: Negotiable
-
R32 Inverter Heat Pump
price: Negotiable